PAB21806

KYAT3 antibody from Abnova Corporation
CCBL2, KAT3, KATIII, RBM1, RP11-82K18.3

Antibody data

Product number
PAB21806
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB21806, RRID:AB_10963894
Product name
CCBL2 polyclonal antibody
Provider product page
Abnova Corporation - PAB21806
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant CCBL2.
Antigen sequence
VTGWKLGWSIGPNHLIKHLQTVQQNTIYTCATPLQ
EALAQAFWIDIKRMDDPECYFNSLPKELEVKRDRM
VRLLESVG
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -