HPA027168

KYAT3 antibody from Sigma-Aldrich
CCBL2, KAT3, KATIII, RBM1, RP11-82K18.3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027168
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA027168, RRID:AB_1852078
Product name
Anti-CCBL2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA027168
Antibody type
Polyclonal
Antigen
Kynurenine--oxoglutarate transaminase 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PDGGYFIIADVSLLDPDLSDMKNNEPYDYKFVKWM
TKHKKLSAIPVSAFCNSETKSQFEKFVRFCFIKKD
STLDAAEEIIKAWSVQKS
Storage
-20C
Provider Type Product Number
- No reagents -