Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA007327 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA007327, RRID:AB_1849941
- Product name
- Anti-GPSM2
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
REVGDKSGELTARLNLSDLQMVLGLSYSTNNSIMS
ENTEIDSSLNGVRPKLGRRHSMENMELMKLTPEKV
QNWNSEILAKQKPLIAKPSAKLLFVNRLKGKKYKT
NSSTKVLQDASNSIDHRIPNSQRKISADTIGDEGF
FDL- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references NuMA interacts with phosphoinositides and links the mitotic spindle with the plasma membrane.
Cortical dynein is critical for proper spindle positioning in human cells.
Kotak S, Busso C, Gönczy P
The EMBO journal 2014 Aug 18;33(16):1815-30
The EMBO journal 2014 Aug 18;33(16):1815-30
Cortical dynein is critical for proper spindle positioning in human cells.
Kotak S, Busso C, Gönczy P
The Journal of cell biology 2012 Oct 1;199(1):97-110
The Journal of cell biology 2012 Oct 1;199(1):97-110
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells in molecular layer and granular layer.
- Sample type
- HUMAN