Antibody data
- Antibody Data
- Antigen structure
- References [6]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA007327 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA007327, RRID:AB_1849941
- Product name
- Anti-GPSM2
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
REVGDKSGELTARLNLSDLQMVLGLSYSTNNSIMS
ENTEIDSSLNGVRPKLGRRHSMENMELMKLTPEKV
QNWNSEILAKQKPLIAKPSAKLLFVNRLKGKKYKT
NSSTKVLQDASNSIDHRIPNSQRKISADTIGDEGF
FDL- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Spontaneous allelic variant in deafness–blindness gene Ush1g resulting in an expanded phenotype
Control of stereocilia length during development of hair bundles
Espin overexpression causes stereocilia defects and provides an anti‐capping effect on actin polymerization
Plk1 regulates spindle orientation by phosphorylating NuMA in human cells
NuMA interacts with phosphoinositides and links the mitotic spindle with the plasma membrane
Cortical dynein is critical for proper spindle positioning in human cells
Vartanian V, Krey J, Chatterjee P, Curtis A, Six M, Rice S, Jones S, Sampath H, Allen C, Ryals R, Lloyd R, Barr‐Gillespie P
Genes, Brain and Behavior 2023;22(4)
Genes, Brain and Behavior 2023;22(4)
Control of stereocilia length during development of hair bundles
Marcotti W, Krey J, Chatterjee P, Halford J, Cunningham C, Perrin B, Barr-Gillespie P
PLOS Biology 2023;21(4):e3001964
PLOS Biology 2023;21(4):e3001964
Espin overexpression causes stereocilia defects and provides an anti‐capping effect on actin polymerization
Zheng L, Adam S, García‐Anoveros J, Mitchell B, Bartles J
Cytoskeleton 2022;79(6-8):64-74
Cytoskeleton 2022;79(6-8):64-74
Plk1 regulates spindle orientation by phosphorylating NuMA in human cells
Sana S, Keshri R, Rajeevan A, Kapoor S, Kotak S
Life Science Alliance 2018;1(6):e201800223
Life Science Alliance 2018;1(6):e201800223
NuMA interacts with phosphoinositides and links the mitotic spindle with the plasma membrane
Kotak S, Busso C, Gönczy P
The EMBO Journal 2014;33(16):1815-1830
The EMBO Journal 2014;33(16):1815-1830
Cortical dynein is critical for proper spindle positioning in human cells
Kotak S, Busso C, Gönczy P
Journal of Cell Biology 2012;199(1):97-110
Journal of Cell Biology 2012;199(1):97-110
No comments: Submit comment
No validations: Submit validation data