HPA008408

GPSM2 antibody from Sigma-Aldrich
DFNB82, LGN, Pins
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008408
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008408, RRID:AB_1849939
Product name
Anti-GPSM2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008408
Antibody type
Polyclonal
Antigen
G-protein-signaling modulator 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FQSNRMDDQRCCLQEKNCHTASTTTSSTPPKMMLK
TSSVPVVSPNTDEFLDLLASSQSRRLDDQRASFSN
LPGLRLTQNSQSVLSHLMTNDNKEADEDFFD
Storage
-20C
Provider Type Product Number
- No reagents -