HPA023048

SLC25A10 antibody from Sigma-Aldrich
DIC
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023048
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023048, RRID:AB_2301950
Product name
Anti-SLC25A10 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023048
Antibody type
Polyclonal
Antigen
Mitochondrial dicarboxylate carrier recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SLTRFAIYETVRDRVAKGSQGPLPFHEKVLLGSVS
GLAGGFVGTPADLVNVRMQNDVKLPQGQRRNYAHA
L
Storage
-20C
Provider Type Product Number
- No reagents -