HPA022274

MFSD6 antibody from Atlas Antibodies
FLJ20160
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA022274
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA022274, RRID:AB_2142776
Product name
Anti-MFSD6
Provider product page
Atlas Antibodies - HPA022274
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
PVPSSPVPIATIDLVQQQTEDVMPRIEPRLPPKKT
KHQEEQEDVNKPAWGVSSSPWVTFVYALYQIKEMM
QLTRDNRASEIQPLQGTNENRENSPAGRAQPVPCE
THSDPSRNQPSPDAAASQTQTSPAHPSVDPC
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -