Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [8]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00007957-M02 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00007957-M02, RRID:AB_530037
- Product name
- EPM2A monoclonal antibody (M02), clone 6C6
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant EPM2A.
- Antigen sequence
GNGPHHDRCCTYNENNLVDGVYCLPIGHWIEATGH
TNEMKHTTDFYFNIAGHQAMHYSRILPNIWLGSCP
RQVEHVTIKLKHELGITAVMNFQTEWDIV- Isotype
- IgG
- Antibody clone number
- 6C6
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Muscle glycogen remodeling and glycogen phosphate metabolism following exhaustive exercise of wild type and laforin knockout mice.
The carbohydrate-binding domain of overexpressed STBD1 is important for its stability and protein-protein interactions.
A bioassay for Lafora disease and laforin glucan phosphatase activity.
Early-onset Lafora body disease.
Increased laforin and laforin binding to glycogen underlie Lafora body formation in malin-deficient Lafora disease.
Laforin and malin knockout mice have normal glucose disposal and insulin sensitivity.
Glycogen hyperphosphorylation underlies lafora body formation.
Laforin is a glycogen phosphatase, deficiency of which leads to elevated phosphorylation of glycogen in vivo.
Irimia JM, Tagliabracci VS, Meyer CM, Segvich DM, DePaoli-Roach AA, Roach PJ
The Journal of biological chemistry 2015 Sep 11;290(37):22686-98
The Journal of biological chemistry 2015 Sep 11;290(37):22686-98
The carbohydrate-binding domain of overexpressed STBD1 is important for its stability and protein-protein interactions.
Zhu Y, Zhang M, Kelly AR, Cheng A
Bioscience reports 2014 Jul 1;34(4)
Bioscience reports 2014 Jul 1;34(4)
A bioassay for Lafora disease and laforin glucan phosphatase activity.
Sherwood AR, Johnson MB, Delgado-Escueta AV, Gentry MS
Clinical biochemistry 2013 Dec;46(18):1869-76
Clinical biochemistry 2013 Dec;46(18):1869-76
Early-onset Lafora body disease.
Turnbull J, Girard JM, Lohi H, Chan EM, Wang P, Tiberia E, Omer S, Ahmed M, Bennett C, Chakrabarty A, Tyagi A, Liu Y, Pencea N, Zhao X, Scherer SW, Ackerley CA, Minassian BA
Brain : a journal of neurology 2012 Sep;135(Pt 9):2684-98
Brain : a journal of neurology 2012 Sep;135(Pt 9):2684-98
Increased laforin and laforin binding to glycogen underlie Lafora body formation in malin-deficient Lafora disease.
Tiberia E, Turnbull J, Wang T, Ruggieri A, Zhao XC, Pencea N, Israelian J, Wang Y, Ackerley CA, Wang P, Liu Y, Minassian BA
The Journal of biological chemistry 2012 Jul 20;287(30):25650-9
The Journal of biological chemistry 2012 Jul 20;287(30):25650-9
Laforin and malin knockout mice have normal glucose disposal and insulin sensitivity.
DePaoli-Roach AA, Segvich DM, Meyer CM, Rahimi Y, Worby CA, Gentry MS, Roach PJ
Human molecular genetics 2012 Apr 1;21(7):1604-10
Human molecular genetics 2012 Apr 1;21(7):1604-10
Glycogen hyperphosphorylation underlies lafora body formation.
Turnbull J, Wang P, Girard JM, Ruggieri A, Wang TJ, Draginov AG, Kameka AP, Pencea N, Zhao X, Ackerley CA, Minassian BA
Annals of neurology 2010 Dec;68(6):925-33
Annals of neurology 2010 Dec;68(6):925-33
Laforin is a glycogen phosphatase, deficiency of which leads to elevated phosphorylation of glycogen in vivo.
Tagliabracci VS, Turnbull J, Wang W, Girard JM, Zhao X, Skurat AV, Delgado-Escueta AV, Minassian BA, Depaoli-Roach AA, Roach PJ
Proceedings of the National Academy of Sciences of the United States of America 2007 Dec 4;104(49):19262-6
Proceedings of the National Academy of Sciences of the United States of America 2007 Dec 4;104(49):19262-6
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- EPM2A monoclonal antibody (M02), clone 6C6 Western Blot analysis of EPM2A expression in PC-12 ( Cat # L012V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of EPM2A expression in transfected 293T cell line by EPM2A monoclonal antibody (M02), clone 6C6.Lane 1: EPM2A transfected lysate(37.2 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged EPM2A is approximately 1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
