HPA008614

MCF2L antibody from Sigma-Aldrich
ARHGEF14, DBS, KIAA0362, OST
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008614
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008614, RRID:AB_1853622
Product name
Anti-MCF2L antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008614
Antibody type
Polyclonal
Antigen
Guanine nucleotide exchange factor DBS recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ESFALMVKQTAQMLQSFGTELAETELPNDVQSTSS
VLCAHTEKKDKAKEDLRLALKEGHSVLESLRELQA
EGSEPSVNQDQLDNQATVQRLLAQLNETEAAFDEF
WAKHQQKLEQCLQLRHFEQGFREVKAILDA
Storage
-20C
Provider Type Product Number
- No reagents -