HPA021989

ANAPC11 antibody from Atlas Antibodies
APC11, Apc11p, HSPC214, MGC882
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA021989
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA021989, RRID:AB_1844915
Product name
Anti-ANAPC11
Provider product page
Atlas Antibodies - HPA021989
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SPWCLDHSCDLFGITDQVSADGPRACRQGARRRLP
AGVGPVLPLLPHALHPQVAARTAGAAALPHVPPGM
EVQGV
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -