HPA021989

ANAPC11 antibody from Sigma-Aldrich
APC11, Apc11p, HSPC214, MGC882
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021989
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021989, RRID:AB_1844915
Product name
Anti-ANAPC11 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021989
Antibody type
Polyclonal
Antigen
Anaphase-promoting complex subunit 11 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SPWCLDHSCDLFGITDQVSADGPRACRQGARRRLP
AGVGPVLPLLPHALHPQVAARTAGAAALPHVPPGM
EVQGV
Storage
-20C
Provider Type Product Number
- No reagents -