HPA023034

PCYT2 antibody from Sigma-Aldrich
ET
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023034
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023034, RRID:AB_1855095
Product name
Anti-PCYT2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023034
Antibody type
Polyclonal
Antigen
Ethanolamine-phosphate cytidylyltransferase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TAELLSHFKVDLVCHGKTEIIPDRDGSDPYQEPKR
RGIFRQIDSGSNLTTDLIVQRIITNRLEYEARNQK
KEAKELAFLEAARQQAAQPLGERDGDF
Storage
-20C
Provider Type Product Number
- No reagents -