HPA025731

RAB32 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA025731
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA025731, RRID:AB_1856001
Product name
Anti-RAB32 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA025731
Antibody type
Polyclonal
Antigen
Ras-related protein Rab-32 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NKDSSQSPSQVDQFCKEHGFAGWFETSAKDNINIE
EAARFLVEKILVNHQSFPNEENDVDKIKLDQETLR
AENKSQCC
Storage
-20C
Provider Type Product Number
- No reagents -