Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN405875 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Leucine Rich Repeat Containing 8 Family, Member B (LRRC8B) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-LRRC8B antibody: synthetic peptide directed towards the N terminal of human LRRC8B
- Reactivity
- Human, Mouse, Rat, Bovine, Canine
- Host
- Rabbit
- Antigen sequence
PSTSSRLEHFVAILHKCFDSPWTTRALSETVAEQS
VRPLK LSKSKILLSS- Vial size
- 50 µg
Submitted references LRRC8 involved in B cell development belongs to a novel family of leucine-rich repeat proteins.
Protonmotive redox mechanism of the cytochrome b-c1 complex in the respiratory chain: protonmotive ubiquinone cycle.
Kubota K, Kim JY, Sawada A, Tokimasa S, Fujisaki H, Matsuda-Hashii Y, Ozono K, Hara J
FEBS letters 2004 Apr 23;564(1-2):147-52
FEBS letters 2004 Apr 23;564(1-2):147-52
Protonmotive redox mechanism of the cytochrome b-c1 complex in the respiratory chain: protonmotive ubiquinone cycle.
Mitchell P
FEBS letters 1975 Aug 1;56(1):1-6
FEBS letters 1975 Aug 1;56(1):1-6
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image

- Experimental details
- Image(s): Western Blotting