Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA023041 - Provider product page
- Provider
- Atlas Antibodies
- Product name
- Anti-NOTUM
- Antibody type
- Polyclonal
- Antigen
- Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
MAQVKSLAQSLYPCSAQQLNEDLRLHLLLNTSVTC
NDGSPAGYYLKESRGSRRWLLFLEGGWYCFNRENC
DSRYDTMRRLMSSRDWPRTRTGTGILSSQPEEN- Isotype
- IgG
- Vial size
- 100μl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Progenitors oppositely polarize WNT activators and inhibitors to orchestrate tissue development
Dental cell type atlas reveals stem and differentiated cell types in mouse and human teeth
Selective Irreversible Inhibitors of the Wnt-Deacylating Enzyme NOTUM Developed by Activity-Based Protein Profiling
Matos I, Asare A, Levorse J, Ouspenskaia T, de la Cruz-Racelis J, Schuhmacher L, Fuchs E
eLife 2020;9
eLife 2020;9
Dental cell type atlas reveals stem and differentiated cell types in mouse and human teeth
Krivanek J, Soldatov R, Kastriti M, Chontorotzea T, Herdina A, Petersen J, Szarowska B, Landova M, Matejova V, Holla L, Kuchler U, Zdrilic I, Vijaykumar A, Balic A, Marangoni P, Klein O, Neves V, Yianni V, Sharpe P, Harkany T, Metscher B, Bajénoff M, Mina M, Fried K, Kharchenko P, Adameyko I
Nature Communications 2020;11(1)
Nature Communications 2020;11(1)
Selective Irreversible Inhibitors of the Wnt-Deacylating Enzyme NOTUM Developed by Activity-Based Protein Profiling
Suciu R, Cognetta A, Potter Z, Cravatt B
ACS Medicinal Chemistry Letters 2018;9(6):563-568
ACS Medicinal Chemistry Letters 2018;9(6):563-568
No comments: Submit comment
No validations: Submit validation data