HPA026749

ASPSCR1 antibody from Atlas Antibodies
ASPL, ASPS, TUG, UBXD9, UBXN9
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA026749
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA026749, RRID:AB_1845114
Product name
Anti-ASPSCR1
Provider product page
Atlas Antibodies - HPA026749
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
GSSASAGQAAASAPLPLESGELSRGDLSRPEDADT
SGPCCEHTQEKQSTRAPAAAPFVPFSGGGQRLGGP
PGPTRPLTSSS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -