HPA011935

SLC2A8 antibody from Sigma-Aldrich
GLUT8, GLUTX1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA011935
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA011935, RRID:AB_1849760
Product name
Anti-SLC2A8 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA011935
Antibody type
Polyclonal
Antigen
Solute carrier family 2, facilitated glucose transporter member 8 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PRFLLTQHRRQEAMAALRFLWGSEQGWEDPPIGAE
QSFHLALLRQPGIYKP
Storage
-20C
Provider Type Product Number
- No reagents -