HPA011935

SLC2A8 antibody from Atlas Antibodies
GLUT8, GLUTX1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA011935
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA011935, RRID:AB_1234463
Product name
Anti-SLC2A8
Provider product page
Atlas Antibodies - HPA011935
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
PRFLLTQHRRQEAMAALRFLWGSEQGWEDPPIGAE
QSFHLALLRQPGIYKP
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -