HPA011935

SLC2A8 antibody from Atlas Antibodies
GLUT8, GLUTX1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA011935
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA011935, RRID:AB_1849760
Product name
Anti-SLC2A8
Provider product page
Atlas Antibodies - HPA011935
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
PRFLLTQHRRQEAMAALRFLWGSEQGWEDPPIGAE
QSFHLALLRQPGIYKP
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -