Antibody data

Product number
PAB21563
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB21563, RRID:AB_10963923
Product name
LRRC45 polyclonal antibody
Provider product page
Abnova Corporation - PAB21563
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant LRRC45.
Antigen sequence
RTLWRLDLAGNNIPGDVLRAVEQAMGHSQDRLTTF
QENQARTHVLSKEVQHLREEKSKQFLDLMETIDKQ
REEMAKSSRASAARV
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -