HPA023382

LRRC45 antibody from Sigma-Aldrich
MGC20806
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023382
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023382, RRID:AB_1853318
Product name
Anti-LRRC45 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023382
Antibody type
Polyclonal
Antigen
Leucine-rich repeat-containing protein 45 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RTLWRLDLAGNNIPGDVLRAVEQAMGHSQDRLTTF
QENQARTHVLSKEVQHLREEKSKQFLDLMETIDKQ
REEMAKSSRASAARV
Storage
-20C
Provider Type Product Number
- No reagents -