HPA012530

LGR5 antibody from Sigma-Aldrich
FEX, GPR49, GPR67, HG38
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA012530
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA012530, RRID:AB_1849329
Product name
Anti-LGR5 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA012530
Antibody type
Polyclonal
Antigen
Leucine-rich repeat-containing G-protein coupled receptor 5 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AIIHPNAFSTLPSLIKLDLSSNLLSSFPITGLHGL
THLKLTGNHALQSLISSENFPELKVIEMPYAYQCC
AFGVCENAYKISNQWNKGDNSSMDDLHKKDAGMFQ
AQDERDLEDFLLDFEEDLKALHSVQCSPSPGPFKP
CEHLLDG
Storage
-20C
Provider Type Product Number
- No reagents -