Explore
Validate
Learn
ImmunohistochemistryAntibody data
- Antibody Data
- Antigen structure
- References [5]
- Comments [0]
- Validations
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA012530 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA012530, RRID:AB_1849329
- Product name
- Anti-LGR5
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
AIIHPNAFSTLPSLIKLDLSSNLLSSFPITGLHGL
THLKLTGNHALQSLISSENFPELKVIEMPYAYQCC
AFGVCENAYKISNQWNKGDNSSMDDLHKKDAGMFQ
AQDERDLEDFLLDFEEDLKALHSVQCSPSPGPFKP
CEHLLDG- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Chronic chemotherapeutic stress promotes evolution of stemness and WNT/beta-catenin signaling in colorectal cancer cells: implications for clinical use of WNT-signaling inhibitors.
Testing stem cell therapy in a rat model of inflammatory bowel disease: role of bone marrow stem cells and stem cell factor in mucosal regeneration.
Regulation of human lung alveolar multipotent cells by a novel p38α MAPK/miR-17-92 axis
Regulation of human lung alveolar multipotent cells by a novel p38α MAPK/miR-17-92 axis
LGR5 is a negative regulator of tumourigenicity, antagonizes Wnt signalling and regulates cell adhesion in colorectal cancer cell lines.
Ayadi M, Bouygues A, Ouaret D, Ferrand N, Chouaib S, Thiery JP, Muchardt C, Sabbah M, Larsen AK
Oncotarget 2015 Jul 30;6(21):18518-33
Oncotarget 2015 Jul 30;6(21):18518-33
Testing stem cell therapy in a rat model of inflammatory bowel disease: role of bone marrow stem cells and stem cell factor in mucosal regeneration.
Qu B, Xin GR, Zhao LX, Xing H, Lian LY, Jiang HY, Tong JZ, Wang BB, Jin SZ
PloS one 2014;9(10):e107891
PloS one 2014;9(10):e107891
Regulation of human lung alveolar multipotent cells by a novel p38α MAPK/miR-17-92 axis
Oeztuerk-Winder F, Guinot A, Ochalek A, Ventura J
The EMBO Journal 2012;31(16):3506-3506
The EMBO Journal 2012;31(16):3506-3506
Regulation of human lung alveolar multipotent cells by a novel p38α MAPK/miR-17-92 axis
Oeztuerk-Winder F, Guinot A, Ochalek A, Ventura J
The EMBO Journal 2012 August;31(16):3431-3441
The EMBO Journal 2012 August;31(16):3431-3441
LGR5 is a negative regulator of tumourigenicity, antagonizes Wnt signalling and regulates cell adhesion in colorectal cancer cell lines.
Walker F, Zhang HH, Odorizzi A, Burgess AW
PloS one 2011;6(7):e22733
PloS one 2011;6(7):e22733
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human colon shows cytoplasmic positivity in glandular cells.
- Sample type
- HUMAN
