Antibody data

Product number
ABIN504402
Provider
antibodies-online
Product name
anti-G Protein Pathway Suppressor 1 (GPS1) (N-Term) antibody
Provider product page
antibodies-online - ABIN504402
Antibody type
Polyclonal
Antigen
The immunogen for anti-GPS1 antibody: synthetic peptide directed towards the N terminal of human GPS1
Description
Affinity Purified
Reactivity
Human, Mouse, Bovine, Chicken/Avian, Xenopus, Zebrafish
Host
Rabbit
Antigen sequence
PLPVQVFNLQGAVEPMQIDVDPQEDPQNAPDVNYV
VENPS LDLEQYAASY
Epitope
N-Term
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -