HPA023384

DUS1L antibody from MilliporeSigma / Merck KGaA
DUS1, PP3111
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023384
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA023384, RRID:AB_1847879
Product name
Anti-DUS1L antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA023384
Antibody type
Polyclonal
Antigen
tRNA-dihydrouridine synthase 1-like recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LTVHGRTKEQKGPLSGAASWEHIKAVRKAVAIPVF
ANGNIQCLQDVERCLRDTGVQGVMSAEGNLHNPAL
FEGRSPAVWELAEEYLDIVREH
Storage
-20C
Provider Type Product Number
- No reagents -