Antibody data

Product number
HPA020869
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA020869, RRID:AB_1851545
Product name
Anti-C2orf66
Provider product page
Atlas Antibodies - HPA020869
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
TVRNEDKWKPLNNPRNRDLFFRRLQAYFKGRGLDL
GTFPNPFPTNENPRPLSFQSELTASASADYEEQKN
SFHNYLKG
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.