HPA020869

C2orf66 antibody from MilliporeSigma / Merck KGaA
UNQ6411
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA020869
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA020869, RRID:AB_1851545
Product name
Anti-C2orf66 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA020869
Antibody type
Polyclonal
Antigen
Uncharacterized protein C2orf66 Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TVRNEDKWKPLNNPRNRDLFFRRLQAYFKGRGLDL
GTFPNPFPTNENPRPLSFQSELTASASADYEEQKN
SFHNYLKG
Storage
-20C
Provider Type Product Number
- No reagents -