HPA023344

CCDC57 antibody from Sigma-Aldrich
FLJ00130, FLJ23754
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023344
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023344, RRID:AB_1846162
Product name
Anti-CCDC57 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023344
Antibody type
Polyclonal
Antigen
Coiled-coil domain-containing protein 57 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
HEEEISKDFPSSEIQRLREQNTSLRNAIAQMRKEM
EALSHQIPPPIQTAAESTDANQPDPEAGGDAATPD
YVLALEAEIRTLKHKFKTLEKHLEDVLDPLKMSSP
HAESQPSV
Storage
-20C
Provider Type Product Number
- No reagents -