HPA012601

FABP6 antibody from Sigma-Aldrich
I-15P, I-BABP, I-BALB, I-BAP, ILBP, ILBP3, ILLBP
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA012601
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA012601, RRID:AB_1848435
Product name
Anti-FABP6 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA012601
Antibody type
Polyclonal
Antigen
Gastrotropin recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AFTGKFEMESEKNYDEFMKLLGISSDVIEKARNFK
IVTEVQQDGQDFTWSQHYSGGHTMTNKFTVGKESN
IQTMGGKMFKATVQMEGGKLVVNFPNYHQTSEIVG
DKLVEVSTIGGVTYERVSKRLA
Storage
-20C
Provider Type Product Number
- No reagents -