HPA027339

EVI5 antibody from Atlas Antibodies
NB4S
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA027339
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA027339, RRID:AB_1848308
Product name
Anti-EVI5
Provider product page
Atlas Antibodies - HPA027339
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
MVTNKMTAAFRNPSGKQVATDKVAEKLSSTLSWVK
NTVSHTVSQMASQVASPSTSLHTTSSSTTLSTPAL
SPSSPSQLSPD
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -