Antibody data

Product number
H00001056-M15
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00001056-M15, RRID:AB_1573929
Product name
CEL monoclonal antibody (M15), clone 3C8
Provider product page
Abnova Corporation - H00001056-M15
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant CEL.
Antigen sequence
GLRGAKTTFDVYTESWAQDPSQENKKKTVVDFETD
VLFLVPTEIALAQHRANAKSAKTYAYLFSHPSRMP
VYPKWVGADHADDIQYVFGKPFATPTGYRP
Isotype
IgG
Antibody clone number
3C8
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -