HPA018678

BOLL antibody from Sigma-Aldrich
BOULE
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018678
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018678, RRID:AB_1845411
Product name
Anti-BOLL antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018678
Antibody type
Polyclonal
Antigen
Protein boule-like recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ATTQYLPGQWQWSVPQPSASSAPFLYLQPSEVIYQ
PVEIAQDGGCVPPPLSLMETSVPEPYSDHGVQATY
HQVYAPSAI
Storage
-20C
Provider Type Product Number
- No reagents -