HPA018678

BOLL antibody from Atlas Antibodies
BOULE
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA018678
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA018678, RRID:AB_1233563
Product name
Anti-BOLL
Provider product page
Atlas Antibodies - HPA018678
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
ATTQYLPGQWQWSVPQPSASSAPFLYLQPSEVIYQ
PVEIAQDGGCVPPPLSLMETSVPEPYSDHGVQATY
HQVYAPSAI
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -