Explore
Validate
Learn
Western blot
ImmunocytochemistryAntibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Immunocytochemistry [1]
- Immunohistochemistry [9]
Submit
Validation data
Reference
Comment
Report error
- Product number
- AMAb90679 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#AMAb90679, RRID:AB_2665629
- Product name
- Anti-SATB2
- Antibody type
- Monoclonal
- Reactivity
- Human, Rat
- Host
- Mouse
- Conjugate
- Unconjugated
- Antigen sequence
KECPLSQSMISSIVNSTYYANVSATKCQEFGRWYK
KYKKIKVERVERENLSDYCVLGQRPMHLPNMNQLA
SLGKTNEQSPHSQIHHSTPIRNQVPALQPIMSPGL
LSPQLSPQLV- Epitope
- Binds to an epitope located within the peptide sequence SLGKTNEQSPHSQIH as determined by overlapping synthetic peptides.
- Isotype
- IgG
- Antibody clone number
- CL0320
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Prognostic and treatment predictive significance of SATB1 and SATB2 expression in pancreatic and periampullary adenocarcinoma.
SATB1 is an independent prognostic factor in radically resected upper gastrointestinal tract adenocarcinoma.
Elebro J, Heby M, Gaber A, Nodin B, Jonsson L, Fristedt R, Uhlén M, Jirström K, Eberhard J
Journal of translational medicine 2014 Oct 17;12:289
Journal of translational medicine 2014 Oct 17;12:289
SATB1 is an independent prognostic factor in radically resected upper gastrointestinal tract adenocarcinoma.
Hedner C, Gaber A, Korkocic D, Nodin B, Uhlén M, Kuteeva E, Johannesson H, Jirström K, Eberhard J
Virchows Archiv : an international journal of pathology 2014 Dec;465(6):649-59
Virchows Archiv : an international journal of pathology 2014 Dec;465(6):649-59
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescence staining of U-138 MG cells using the Anti-SATB2 monoclonal antibody, showing specific staining in the nucleoplasm in green. Microtubule- and nuclear probes are visualized in red and blue, respectively (where available).
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human rectum shows strong nuclear immunoreactivity in glandular cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human colorectal cancer shows strong nuclear immunoreactivity in tumor cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex shows moderate nuclear positivity in neurons.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human stomach cancer shows weak nuclear positivity in a subset of tumor cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human tonsil shows absence of staining (negative control).
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human breast cancer shows absence of positivity (negative control).
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of rat hippocampal formation shows strong nuclear immunoreactivity in CA1 pyramidal cell layer, as well as in cerebral cortex.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of rat hippocampal formation shows strong nuclear immunoreactivity in CA1 pyramidal cell layer.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of rat hippocampal formation shows absence of nuclear positivity in the polymorph and granular cell layers of dentate gyrus (negative control).
