Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- Immunohistochemistry [7]
Submit
Validation data
Reference
Comment
Report error
- Product number
- AMAb90680 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#AMAb90680, RRID:AB_2665630
- Product name
- Anti-SATB2
- Antibody type
- Monoclonal
- Reactivity
- Human, Rat
- Host
- Mouse
- Conjugate
- Unconjugated
- Antigen sequence
KECPLSQSMISSIVNSTYYANVSATKCQEFGRWYK
KYKKIKVERVERENLSDYCVLGQRPMHLPNMNQLA
SLGKTNEQSPHSQIHHSTPIRNQVPALQPIMSPGL
LSPQLSPQLV- Epitope
- Binds to an epitope located within the peptide sequence KCQEFGRWYKKYKKI as determined by overlapping synthetic peptides.
- Isotype
- IgG
- Antibody clone number
- CL0321
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Lane 1: Marker [kDa]Lane 2: Negative control (vector only transfected HEK293T lysate) Lane 3: SATB2 Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY414656)
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Lane 1: Marker [kDa]Lane 2: Human cell line HEL
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex shows moderate nuclear immunoreactivity in neuronal cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human rectum shows strong nuclear positivity in glandular cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human colorectal cancer shows nuclear immunoreactivity in tumor cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human liver shows absence of staining (negative control).
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of rat hippocampal formation shows strong nuclear immunoreactivity in CA1 pyramidal cell layer, as well as in cerebral cortex.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of rat hippocampal formation shows strong nuclear immunoreactivity in CA1 pyramidal cell layer.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of rat hippocampal formation shows absence of nuclear positivity in the polymorph and granular cell layers of dentate gyrus (negative control).