AMAb90680

SATB2 antibody from Atlas Antibodies
FLJ21474, KIAA1034
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
AMAb90680
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#AMAb90680, RRID:AB_2665630
Product name
Anti-SATB2
Provider product page
Atlas Antibodies - AMAb90680
Antibody type
Monoclonal
Reactivity
Human, Rat
Host
Mouse
Conjugate
Unconjugated
Antigen sequence
KECPLSQSMISSIVNSTYYANVSATKCQEFGRWYK
KYKKIKVERVERENLSDYCVLGQRPMHLPNMNQLA
SLGKTNEQSPHSQIHHSTPIRNQVPALQPIMSPGL
LSPQLSPQLV
Epitope
Binds to an epitope located within the peptide sequence KCQEFGRWYKKYKKI as determined by overlapping synthetic peptides.
Isotype
IgG
Antibody clone number
CL0321
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -