Antibody data
- Antibody Data
- Antigen structure
- References [4]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [9]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA001042 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA001042, RRID:AB_10601711
- Product name
- Anti-SATB2
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
VSQAVFARVAFNRTQGLLSEILRKEEDPRTASQSL
LVNLRAMQNFLNLPEVERDRIYQDERERSMNPNVS
MVSSASSSPSSSRTPQAKTSTPTTDLPIKVDGANI
NITAAIYDEIQQEMKRAK- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Generation of monospecific antibodies based on affinity capture of polyclonal antibodies
SATB2 in Combination With Cytokeratin 20 Identifies Over 95% of all Colorectal Carcinomas
Extensive expression of craniofacial related homeobox genes in canine mammary sarcomas
From Gene Expression Analysis to Tissue Microarrays: A Rational Approach to Identify Therapeutic and Diagnostic Targets in Lymphoid Malignancies
Hjelm B, Forsström B, Igel U, Johannesson H, Stadler C, Lundberg E, Ponten F, Sjöberg A, Rockberg J, Schwenk J, Nilsson P, Johansson C, Uhlén M
Protein Science 2011 November;20(11):1824-1835
Protein Science 2011 November;20(11):1824-1835
SATB2 in Combination With Cytokeratin 20 Identifies Over 95% of all Colorectal Carcinomas
Magnusson K, de Wit M, Brennan D, Johnson L, McGee S, Lundberg E, Naicker K, Klinger R, Kampf C, Asplund A, Wester K, Gry M, Bjartell A, Gallagher W, Rexhepaj E, Kilpinen S, Kallioniemi O, Belt E, Goos J, Meijer G, Birgisson H, Glimelius B, Borrebaeck C, Navani S, Uhlén M, OʼConnor D, Jirström K, Pontén F
The American Journal of Surgical Pathology 2011 ;35(7):937-948
The American Journal of Surgical Pathology 2011 ;35(7):937-948
Extensive expression of craniofacial related homeobox genes in canine mammary sarcomas
Wensman H, Göransson H, Leuchowius K, Strömberg S, Pontén F, Isaksson A, Rutteman G, Heldin N, Pejler G, Hellmén E
Breast Cancer Research and Treatment 2009 November;118(2):333-343
Breast Cancer Research and Treatment 2009 November;118(2):333-343
From Gene Expression Analysis to Tissue Microarrays: A Rational Approach to Identify Therapeutic and Diagnostic Targets in Lymphoid Malignancies
Ek S
Molecular & Cellular Proteomics 2006 March;5(6):1072-1081
Molecular & Cellular Proteomics 2006 March;5(6):1072-1081
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Western blot analysis in human cell line HEL.
Enhanced validation
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human colon and liver tissues using HPA001042 antibody. Corresponding SATB2 RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Independent antibody validation
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex, colon, liver and rectum using Anti-SATB2 antibody HPA001042 (A) shows similar protein distribution across tissues to independent antibody HPA029543 (B).
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human colon shows strong nuclear positivity in glandular cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human colorectal cancer shows strong nuclear positivity in tumor cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex shows strong nuclear positivity in neurons.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human liver shows no positivity in hepatocytes as expected.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human rectum using Anti-SATB2 antibody HPA001042.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human colon shows strong nuclear positivity in glandular cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human rectum shows strong nuclear positivity in glandular cells.
- Sample type
- HUMAN