Explore
Validate
Learn
Western blot
ImmunohistochemistryAntibody data
- Antibody Data
- Antigen structure
- References [4]
- Comments [0]
- Validations
- Immunohistochemistry [5]
Submit
Validation data
Reference
Comment
Report error
- Product number
- AMAb90635 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#AMAb90635, RRID:AB_2665615
- Product name
- Anti-SATB2
- Antibody type
- Monoclonal
- Reactivity
- Human
- Host
- Mouse
- Conjugate
- Unconjugated
- Antigen sequence
VSQAVFARVAFNRTQGLLSEILRKEEDPRTASQSL
LVNLRAMQNFLNLPEVERDRIYQDERERSMNPNVS
MVSSASSSPSSSRTPQAKTSTPTTDLPIKVDGANI
NITAAIYDEIQQEMKRAK- Epitope
- Binds to an epitope located within the peptide sequence LVNLRAMQNFLNLPE as determined by overlapping synthetic peptides.
- Isotype
- IgG
- Antibody clone number
- CL0276
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Evaluating real-time immunohistochemistry on multiple tissue samples, multiple targets and multiple antibody labeling methods.
Scalable in situ hybridization on tissue arrays for validation of novel cancer and tissue-specific biomarkers.
A cohort study of the prognostic and treatment predictive value of SATB2 expression in colorectal cancer.
Epitope mapping of antibodies using bacterial surface display.
Dubois L, Andersson K, Asplund A, Björkelund H
BMC research notes 2013 Dec 18;6:542
BMC research notes 2013 Dec 18;6:542
Scalable in situ hybridization on tissue arrays for validation of novel cancer and tissue-specific biomarkers.
Kiflemariam S, Andersson S, Asplund A, Pontén F, Sjöblom T
PloS one 2012;7(3):e32927
PloS one 2012;7(3):e32927
A cohort study of the prognostic and treatment predictive value of SATB2 expression in colorectal cancer.
Eberhard J, Gaber A, Wangefjord S, Nodin B, Uhlén M, Ericson Lindquist K, Jirström K
British journal of cancer 2012 Feb 28;106(5):931-8
British journal of cancer 2012 Feb 28;106(5):931-8
Epitope mapping of antibodies using bacterial surface display.
Rockberg J, Löfblom J, Hjelm B, Uhlén M, Ståhl S
Nature methods 2008 Dec;5(12):1039-45
Nature methods 2008 Dec;5(12):1039-45
No comments: Submit comment
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human rectum and skeletal muscle tissues using AMAb90635 antibody. Corresponding SATB2 RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human rectum shows strong nuclear positivity in glandular cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human colorectal cancer shows moderate to strong nuclear positivity in tumor cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex shows strong nuclear positivity in neurons.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human skeletal muscle shows no positivity in striated muscle fibers, as expected.
