HPA001042

SATB2 antibody from Sigma-Aldrich
FLJ21474, KIAA1034
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001042
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001042, RRID:AB_10601711
Product name
Anti-SATB2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001042
Antibody type
Polyclonal
Antigen
SATB homeobox 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VSQAVFARVAFNRTQGLLSEILRKEEDPRTASQSL
LVNLRAMQNFLNLPEVERDRIYQDERERSMNPNVS
MVSSASSSPSSSRTPQAKTSTPTTDLPIKVDGANI
NITAAIYDEIQQEMKRAK
Storage
-20C
Provider Type Product Number
- No reagents -