HPA017886

WDR45B antibody from Sigma-Aldrich
WDR45L, WIPI3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017886
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017886, RRID:AB_1858810
Product name
Anti-WDR45L antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017886
Antibody type
Polyclonal
Antigen
WD repeat domain phosphoinositide-interacting protein 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LFRCNYLALVGGGKKPKYPPNKVMIWDDLKKKTVI
EIEFSTEVKAVKLRRDRIVVVLDSMIKVFTFTHNP
HQLHVFETCYNPKGLCVLCPNSNNSLLAFPGTHTG
HVQLVDLASTEKPPVDIPAHEGVLSCIALNLQGTR
IATASEKG
Storage
-20C
Provider Type Product Number
- No reagents -