HPA007191

CYTIP antibody from Sigma-Aldrich
B3-1, CASP, CYBR, CYTHIP, HE, PSCDBP
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007191
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007191, RRID:AB_1855801
Product name
Anti-PSCDBP antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007191
Antibody type
Polyclonal
Antigen
Cytohesin-interacting protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PAYSSYSTLTGSLTMDDNRRIQMLADTVATLPRGR
KQLALTRSSSLSDFSWSQRKLVTVEKQDNETFGFE
IQSYRPQNQNACSSEMFTLICKIQEDSPAHCAGLQ
AGDVLANINGVSTEGF
Storage
-20C
Provider Type Product Number
- No reagents -