HPA023012

ZNF750 antibody from Sigma-Aldrich
FLJ13841, Zfp750
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023012
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023012, RRID:AB_1859439
Product name
Anti-ZNF750 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023012
Antibody type
Polyclonal
Antigen
Protein ZNF750 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PKQTNQPDATAKPASSKSVANGLSAFDSKLQHSSA
REDIKENLELQARGTHRCLGQKPALHRASPCKSPA
PEAALGAQPALEGAARPSAFVPVGEHRLKGPDNAE
APETLALHNP
Storage
-20C
Provider Type Product Number
- No reagents -