HPA023585

B3GNTL1 antibody from Atlas Antibodies
B3GNT8
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA023585
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA023585, RRID:AB_2061075
Product name
Anti-B3GNTL1
Provider product page
Atlas Antibodies - HPA023585
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SSGSYLCFLDSDDVMMPQRVRLQHEAAVQHPSSII
GCRVRRDPPNSTERYTRWINQLTPEQLLTQVFTSN
GPTV
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -