HPA024547

B3GNTL1 antibody from MilliporeSigma / Merck KGaA
B3GNT8
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024547
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA024547, RRID:AB_1845240
Product name
Anti-B3GNTL1 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA024547
Antibody type
Polyclonal
Antigen
UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase-like protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ASEESQAMQAHVSIILPVHNAEPWLDECLRSVLQQ
DFEGTMELSVFNDASKDKSGAIIEKWRVKLEDSGV
HVIIGGHDSPSP
Storage
-20C
Provider Type Product Number
- No reagents -