HPA023458

ZBTB2 antibody from Atlas Antibodies
bA351K16.2, KIAA1483, ZNF437
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA023458
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA023458, RRID:AB_1858944
Product name
Anti-ZBTB2
Provider product page
Atlas Antibodies - HPA023458
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
DTYTMVDKQTLELCTFEEGSQMDNMLVQTNKPYKC
NLCDKTFSTPNEVVKHSCQNQNSDVFALDEGRSIL
LGSGDSEVTEPDHPVLASIK
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -