HPA023792

METRNL antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023792
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023792, RRID:AB_2144182
Product name
Anti-METRNL antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023792
Antibody type
Polyclonal
Antigen
Meteorin-like protein Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QYSSDRCSWKGSGLTHEAHRKEVEQVYLRCAAGAV
EWMYPTGALIVNLRPNTFSPARHLTVCIRSFTDSS
Storage
-20C
Provider Type Product Number
- No reagents -