HPA008410

CKAP2 antibody from Atlas Antibodies
FLJ10749, LB1, se20-10, TMAP
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA008410
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA008410, RRID:AB_1846832
Product name
Anti-CKAP2
Provider product page
Atlas Antibodies - HPA008410
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
PPIRSHHSNTRDTVKQGISRTSANVTIRKGPHEKE
LLQSKTALSSVKTSSSQGIIRNKTLSRSIASEVVA
RPASLSNDKLMEKSEPVDQRRHTAGKAIVDSRSAQ
PKETSEERKARLSEWKAGKGR
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -