HPA019113

SYNE1 antibody from Sigma-Aldrich
8B, ARCA1, C6orf98, CPG2, dJ45H2.2, enaptin, KIAA0796, MYNE1, Nesp1, Nesprin-1, SCAR8, SYNE-1B
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019113
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019113, RRID:AB_1857707
Product name
Anti-SYNE1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019113
Antibody type
Polyclonal
Antigen
Nesprin-1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SRDLESAMSRALPSEDEEGQDDKDFYLRGAVGLSG
DHSALESQIRQLGKALDDSRFQIQQTENIIRSKTP
TGPELDTSYKGYMKLLGECSSSIDSVKRLEHKLKE
EEESLPGFVNLHSTETQTAGVIDRWEL
Storage
-20C
Provider Type Product Number
- No reagents -