HPA019113

SYNE1 antibody from Atlas Antibodies
8B, ARCA1, C6orf98, CPG2, dJ45H2.2, enaptin, KIAA0796, MYNE1, Nesp1, Nesprin-1, SCAR8, SYNE-1B
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA019113
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA019113, RRID:AB_1857707
Product name
Anti-SYNE1
Provider product page
Atlas Antibodies - HPA019113
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SRDLESAMSRALPSEDEEGQDDKDFYLRGAVGLSG
DHSALESQIRQLGKALDDSRFQIQQTENIIRSKTP
TGPELDTSYKGYMKLLGECSSSIDSVKRLEHKLKE
EEESLPGFVNLHSTETQTAGVIDRWEL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -