HPA015827

TRAK2 antibody from Sigma-Aldrich
ALS2CR3, CALS-C, GRIF-1, KIAA0549, MILT2, OIP98
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015827
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA015827, RRID:AB_1858238
Product name
Anti-TRAK2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA015827
Antibody type
Polyclonal
Antigen
Trafficking kinesin-binding protein 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
HLYFSQSYGAFTGESLAAEIEGTMRKKLSLDEESS
LFKQKAQQKRVFDTVRIANDTRGRSISFPALLPIP
GSNRSSVIMTAKPFESGLQQTEDKSLLNQGSSSEE
VAGSSQKMGQPGPSGDSDLATALHR
Storage
-20C
Provider Type Product Number
- No reagents -