HPA015827

TRAK2 antibody from Atlas Antibodies
ALS2CR3, CALS-C, GRIF-1, KIAA0549, MILT2, OIP98
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA015827
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA015827, RRID:AB_1858238
Product name
Anti-TRAK2
Provider product page
Atlas Antibodies - HPA015827
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
HLYFSQSYGAFTGESLAAEIEGTMRKKLSLDEESS
LFKQKAQQKRVFDTVRIANDTRGRSISFPALLPIP
GSNRSSVIMTAKPFESGLQQTEDKSLLNQGSSSEE
VAGSSQKMGQPGPSGDSDLATALHR
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -