HPA026549

STRADB antibody from Atlas Antibodies
ALS2CR2, CALS-21, ILPIP, ILPIPA, PAPK
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA026549
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA026549, RRID:AB_1844779
Product name
Anti-STRADB
Provider product page
Atlas Antibodies - HPA026549
Antibody type
Polyclonal
Reactivity
Human, Mouse
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
VPFQDMHRTQMLLQKLKGPPYSPLDISIFPQSESR
MKNSQSGVDSGIGESVLVSSGTHTVNSDRLHTPSS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -