HPA026549

STRADB antibody from Sigma-Aldrich
ALS2CR2, CALS-21, ILPIP, ILPIPA, PAPK
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA026549
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA026549, RRID:AB_1844779
Product name
Anti-STRADB antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA026549
Antibody type
Polyclonal
Antigen
STE20-related kinase adapter protein beta recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VPFQDMHRTQMLLQKLKGPPYSPLDISIFPQSESR
MKNSQSGVDSGIGESVLVSSGTHTVNSDRLHTPSS
Storage
-20C
Provider Type Product Number
- No reagents -